Placeholder image of a protein
Icon representing a puzzle

2409: : Electron Density Reconstruction 75

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
January 19, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but there are some gaps in the visible segments.

Sequence
GSNLAAWKISIPYVDFFEDPSSERKEKKERIPVFCIDVERNDRRAVGHEPEHWSVYRRYLEFYVLESKLTEFHGAFPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQKLLQHPELSNSQLLADFLSPN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 21,635
  2. Avatar for Go Science 2. Go Science 63 pts. 21,632
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 21,578
  4. Avatar for Contenders 4. Contenders 21 pts. 21,557
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 21,530
  6. Avatar for Australia 6. Australia 5 pts. 21,464
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 21,397
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 21,341
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 21,118
  10. Avatar for VeFold 10. VeFold 1 pt. 21,047

  1. Avatar for Steven Pletsch 21. Steven Pletsch Lv 1 17 pts. 21,484
  2. Avatar for AlkiP0Ps 22. AlkiP0Ps Lv 1 15 pts. 21,464
  3. Avatar for WBarme1234 23. WBarme1234 Lv 1 14 pts. 21,397
  4. Avatar for MicElephant 24. MicElephant Lv 1 12 pts. 21,366
  5. Avatar for Joanna_H 25. Joanna_H Lv 1 11 pts. 21,341
  6. Avatar for rosie4loop 26. rosie4loop Lv 1 10 pts. 21,310
  7. Avatar for jausmh 27. jausmh Lv 1 9 pts. 21,306
  8. Avatar for georg137 28. georg137 Lv 1 8 pts. 21,289
  9. Avatar for maithra 29. maithra Lv 1 7 pts. 21,267
  10. Avatar for alcor29 30. alcor29 Lv 1 6 pts. 21,264

Comments