Placeholder image of a protein
Icon representing a puzzle

2409: : Electron Density Reconstruction 75

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
January 19, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but there are some gaps in the visible segments.

Sequence
GSNLAAWKISIPYVDFFEDPSSERKEKKERIPVFCIDVERNDRRAVGHEPEHWSVYRRYLEFYVLESKLTEFHGAFPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQKLLQHPELSNSQLLADFLSPN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 21,635
  2. Avatar for Go Science 2. Go Science 63 pts. 21,632
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 21,578
  4. Avatar for Contenders 4. Contenders 21 pts. 21,557
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 21,530
  6. Avatar for Australia 6. Australia 5 pts. 21,464
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 21,397
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 21,341
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 21,118
  10. Avatar for VeFold 10. VeFold 1 pt. 21,047

  1. Avatar for VU21BTEN0100033 61. VU21BTEN0100033 Lv 1 1 pt. 20,066
  2. Avatar for furi0us 62. furi0us Lv 1 1 pt. 20,046
  3. Avatar for Belle36 63. Belle36 Lv 1 1 pt. 20,003
  4. Avatar for Avijit Pandey 64. Avijit Pandey Lv 1 1 pt. 18,382
  5. Avatar for drjr 65. drjr Lv 1 1 pt. 17,962
  6. Avatar for Wiz kid 66. Wiz kid Lv 1 1 pt. 16,944
  7. Avatar for rmoretti 67. rmoretti Lv 1 1 pt. 12,158

Comments