Placeholder image of a protein
Icon representing a puzzle

2409: : Electron Density Reconstruction 75

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
January 19, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but there are some gaps in the visible segments.

Sequence
GSNLAAWKISIPYVDFFEDPSSERKEKKERIPVFCIDVERNDRRAVGHEPEHWSVYRRYLEFYVLESKLTEFHGAFPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQKLLQHPELSNSQLLADFLSPN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 21,635
  2. Avatar for Go Science 2. Go Science 63 pts. 21,632
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 21,578
  4. Avatar for Contenders 4. Contenders 21 pts. 21,557
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 21,530
  6. Avatar for Australia 6. Australia 5 pts. 21,464
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 21,397
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 21,341
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 21,118
  10. Avatar for VeFold 10. VeFold 1 pt. 21,047
  1. Avatar for Vinara 51. Vinara Lv 1 1 pt. 20,484
  2. Avatar for Arne Heessels 52. Arne Heessels Lv 1 1 pt. 20,364
  3. Avatar for pruneau_44 53. pruneau_44 Lv 1 1 pt. 20,318
  4. Avatar for Mohoernchen 54. Mohoernchen Lv 1 1 pt. 20,304
  5. Avatar for Dr.Sillem 55. Dr.Sillem Lv 1 1 pt. 20,272
  6. Avatar for carxo 56. carxo Lv 1 1 pt. 20,208
  7. Avatar for DScott 57. DScott Lv 1 1 pt. 20,183
  8. Avatar for moduyilong 58. moduyilong Lv 1 1 pt. 20,156
  9. Avatar for rinze 59. rinze Lv 1 1 pt. 20,080
  10. Avatar for spvincent 60. spvincent Lv 1 1 pt. 20,068

Comments