Placeholder image of a protein
Icon representing a puzzle

2412: Electron Density Reconstruction 76

Closed since about 2 years ago

Novice Prediction Electron Density Kinect

Summary


Created
January 25, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but not every segment may be visible.

Sequence
SMYQLWKMILQETGKNAVPSYGLYGCNCGVGSRGKPKDATDRCCFVHKCCYKKLTDCSPKTDSYSYSWKDKTIVCGDNNPCLQEMCECDKAVAICLRENLDTYNKNYKIYPKPLCKKADAC

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 21,390
  2. Avatar for Go Science 2. Go Science 56 pts. 21,372
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 29 pts. 21,345
  4. Avatar for Contenders 4. Contenders 14 pts. 21,321
  5. Avatar for Australia 5. Australia 6 pts. 21,309
  6. Avatar for Marvin's bunch 6. Marvin's bunch 2 pts. 21,247
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 21,155
  8. Avatar for VeFold 8. VeFold 1 pt. 20,856
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 20,723
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 20,513

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 21,388
  2. Avatar for LociOiling 2. LociOiling Lv 1 47 pts. 21,386
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 19 pts. 21,372
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 7 pts. 21,347
  5. Avatar for Steven Pletsch 5. Steven Pletsch Lv 1 2 pts. 21,329
  6. Avatar for fpc 6. fpc Lv 1 1 pt. 21,247
  7. Avatar for alcor29 7. alcor29 Lv 1 1 pt. 21,232
  8. Avatar for silent gene 8. silent gene Lv 1 1 pt. 21,162

Comments