2412: Electron Density Reconstruction 76
Closed since about 2 years ago
Novice Novice Novice Novice Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Kinect Kinect Kinect KinectSummary
- Created
- January 25, 2024
- Expires
- Max points
- 100
The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but not every segment may be visible.
- Sequence
- SMYQLWKMILQETGKNAVPSYGLYGCNCGVGSRGKPKDATDRCCFVHKCCYKKLTDCSPKTDSYSYSWKDKTIVCGDNNPCLQEMCECDKAVAICLRENLDTYNKNYKIYPKPLCKKADAC
