Placeholder image of a protein
Icon representing a puzzle

2412: Electron Density Reconstruction 76

Closed since about 2 years ago

Novice Novice Prediction Prediction Electron Density Electron Density Kinect Kinect

Summary


Created
January 25, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but not every segment may be visible.

Sequence
SMYQLWKMILQETGKNAVPSYGLYGCNCGVGSRGKPKDATDRCCFVHKCCYKKLTDCSPKTDSYSYSWKDKTIVCGDNNPCLQEMCECDKAVAICLRENLDTYNKNYKIYPKPLCKKADAC

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 21,390
  2. Avatar for Go Science 2. Go Science 56 pts. 21,372
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 29 pts. 21,345
  4. Avatar for Contenders 4. Contenders 14 pts. 21,321
  5. Avatar for Australia 5. Australia 6 pts. 21,309
  6. Avatar for Marvin's bunch 6. Marvin's bunch 2 pts. 21,247
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 21,155
  8. Avatar for VeFold 8. VeFold 1 pt. 20,856
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 20,723
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 20,513

  1. Avatar for Trajan464 31. Trajan464 Lv 1 4 pts. 20,865
  2. Avatar for kitsoune 32. kitsoune Lv 1 4 pts. 20,856
  3. Avatar for zbp 33. zbp Lv 1 3 pts. 20,834
  4. Avatar for maithra 34. maithra Lv 1 3 pts. 20,821
  5. Avatar for drjr 35. drjr Lv 1 2 pts. 20,791
  6. Avatar for pizpot 36. pizpot Lv 1 2 pts. 20,780
  7. Avatar for Joanna_H 37. Joanna_H Lv 1 2 pts. 20,723
  8. Avatar for Bautho 38. Bautho Lv 1 2 pts. 20,708
  9. Avatar for Larini 39. Larini Lv 1 1 pt. 20,688
  10. Avatar for ProfVince 40. ProfVince Lv 1 1 pt. 20,659

Comments