Placeholder image of a protein
Icon representing a puzzle

2412: Electron Density Reconstruction 76

Closed since about 2 years ago

Novice Novice Prediction Prediction Electron Density Electron Density Kinect Kinect

Summary

Created
January 25, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but not every segment may be visible.

Sequence
SMYQLWKMILQETGKNAVPSYGLYGCNCGVGSRGKPKDATDRCCFVHKCCYKKLTDCSPKTDSYSYSWKDKTIVCGDNNPCLQEMCECDKAVAICLRENLDTYNKNYKIYPKPLCKKADAC

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 21,390
  2. Avatar for Go Science 2. Go Science 56 pts. 21,372
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 29 pts. 21,345
  4. Avatar for Contenders 4. Contenders 14 pts. 21,321
  5. Avatar for Australia 5. Australia 6 pts. 21,309
  6. Avatar for Marvin's bunch 6. Marvin's bunch 2 pts. 21,247
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 21,155
  8. Avatar for VeFold 8. VeFold 1 pt. 20,856
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 20,723
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 20,513
  1. Avatar for PPM 61. PPM Lv 1 1 pt. 13,971
  2. Avatar for Sr.Noname 62. Sr.Noname Lv 1 1 pt. 13,663
  3. Avatar for NPrincipi 63. NPrincipi Lv 1 1 pt. 13,374

Comments