Icon representing a puzzle

2414: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 9,426

  1. Avatar for silent gene 21. silent gene Lv 1 23 pts. 11,292
  2. Avatar for guineapig 22. guineapig Lv 1 21 pts. 11,285
  3. Avatar for AlkiP0Ps 23. AlkiP0Ps Lv 1 19 pts. 11,259
  4. Avatar for akaaka 24. akaaka Lv 1 17 pts. 11,216
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 16 pts. 11,190
  6. Avatar for Idiotboy 26. Idiotboy Lv 1 15 pts. 11,167
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 13 pts. 11,114
  8. Avatar for pizpot 28. pizpot Lv 1 12 pts. 11,071
  9. Avatar for ProfVince 29. ProfVince Lv 1 11 pts. 11,070
  10. Avatar for zbp 30. zbp Lv 1 10 pts. 11,064

Comments