Icon representing a puzzle

2414: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 9,426
  1. Avatar for Dr.Sillem 51. Dr.Sillem Lv 1 1 pt. 10,529
  2. Avatar for carxo 52. carxo Lv 1 1 pt. 10,519
  3. Avatar for pfirth 53. pfirth Lv 1 1 pt. 10,518
  4. Avatar for rinze 54. rinze Lv 1 1 pt. 10,509
  5. Avatar for DScott 55. DScott Lv 1 1 pt. 10,509
  6. Avatar for Mohoernchen 56. Mohoernchen Lv 1 1 pt. 10,463
  7. Avatar for c-lindane 57. c-lindane Lv 1 1 pt. 10,434
  8. Avatar for Merf 58. Merf Lv 1 1 pt. 10,419
  9. Avatar for mmonter3 59. mmonter3 Lv 1 1 pt. 10,185
  10. Avatar for froschi2 60. froschi2 Lv 1 1 pt. 10,174

Comments