Icon representing a puzzle

2414: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,700
  2. Avatar for Go Science 2. Go Science 60 pts. 11,620
  3. Avatar for Contenders 3. Contenders 33 pts. 11,479
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 11,364
  5. Avatar for Australia 5. Australia 8 pts. 11,259
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 11,190
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 11,114
  8. Avatar for VeFold 8. VeFold 1 pt. 11,071
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,942
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 10,840
  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 50 pts. 11,367
  2. Avatar for blazegeek 12. blazegeek Lv 1 47 pts. 11,365
  3. Avatar for fpc 13. fpc Lv 1 43 pts. 11,364
  4. Avatar for Serca 14. Serca Lv 1 40 pts. 11,356
  5. Avatar for BootsMcGraw 15. BootsMcGraw Lv 1 37 pts. 11,356
  6. Avatar for gmn 16. gmn Lv 1 34 pts. 11,346
  7. Avatar for roarshock 17. roarshock Lv 1 32 pts. 11,337
  8. Avatar for phi16 18. phi16 Lv 1 29 pts. 11,334
  9. Avatar for g_b 19. g_b Lv 1 27 pts. 11,327
  10. Avatar for georg137 20. georg137 Lv 1 25 pts. 11,300

Comments