Icon representing a puzzle

2414: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,700
  2. Avatar for Go Science 2. Go Science 60 pts. 11,620
  3. Avatar for Contenders 3. Contenders 33 pts. 11,479
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 11,364
  5. Avatar for Australia 5. Australia 8 pts. 11,259
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 11,190
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 11,114
  8. Avatar for VeFold 8. VeFold 1 pt. 11,071
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,942
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 10,840
  1. Avatar for nicobul 41. nicobul Lv 1 3 pts. 10,877
  2. Avatar for maithra 42. maithra Lv 1 3 pts. 10,858
  3. Avatar for AlphaFold2 43. AlphaFold2 Lv 1 2 pts. 10,840
  4. Avatar for fordesk 44. fordesk Lv 1 2 pts. 10,797
  5. Avatar for Steven Pletsch 45. Steven Pletsch Lv 1 2 pts. 10,783
  6. Avatar for Trajan464 46. Trajan464 Lv 1 2 pts. 10,768
  7. Avatar for Vinara 47. Vinara Lv 1 2 pts. 10,766
  8. Avatar for ivalnic 48. ivalnic Lv 1 1 pt. 10,752
  9. Avatar for Deleted player 49. Deleted player 1 pt. 10,634
  10. Avatar for Arne Heessels 50. Arne Heessels Lv 1 1 pt. 10,571

Comments