Icon representing a puzzle

2414: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,700
  2. Avatar for Go Science 2. Go Science 60 pts. 11,620
  3. Avatar for Contenders 3. Contenders 33 pts. 11,479
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 11,364
  5. Avatar for Australia 5. Australia 8 pts. 11,259
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 11,190
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 11,114
  8. Avatar for VeFold 8. VeFold 1 pt. 11,071
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,942
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 10,840
  1. Avatar for Maryann 61. Maryann Lv 1 1 pt. 10,171
  2. Avatar for eandra20 62. eandra20 Lv 1 1 pt. 10,171
  3. Avatar for Belle36 63. Belle36 Lv 1 1 pt. 10,167
  4. Avatar for ahnguy72 64. ahnguy72 Lv 1 1 pt. 10,160
  5. Avatar for Dpadillaleos 65. Dpadillaleos Lv 1 1 pt. 10,158
  6. Avatar for Donkus_St_George 66. Donkus_St_George Lv 1 1 pt. 10,147
  7. Avatar for kolasola 67. kolasola Lv 1 1 pt. 10,138
  8. Avatar for 4224 68. 4224 Lv 1 1 pt. 10,092
  9. Avatar for iburdwell 69. iburdwell Lv 1 1 pt. 10,089
  10. Avatar for furi0us 70. furi0us Lv 1 1 pt. 10,023

Comments