Icon representing a puzzle

2417: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 10,705
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 10,609
  3. Avatar for That's a Wrap! 13. That's a Wrap! 1 pt. 10,006
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,897
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,873
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,078
  2. Avatar for MicElephant 2. MicElephant Lv 1 94 pts. 11,850
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 88 pts. 11,845
  4. Avatar for BackBuffer 4. BackBuffer Lv 1 83 pts. 11,843
  5. Avatar for blazegeek 5. blazegeek Lv 1 78 pts. 11,815
  6. Avatar for WBarme1234 6. WBarme1234 Lv 1 73 pts. 11,803
  7. Avatar for akaaka 7. akaaka Lv 1 68 pts. 11,791
  8. Avatar for Punzi Baker 3 8. Punzi Baker 3 Lv 1 63 pts. 11,791
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 59 pts. 11,784
  10. Avatar for Galaxie 10. Galaxie Lv 1 55 pts. 11,781

Comments