Icon representing a puzzle

2417: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 2 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,095
  2. Avatar for Contenders 2. Contenders 70 pts. 11,850
  3. Avatar for Go Science 3. Go Science 47 pts. 11,845
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 30 pts. 11,803
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 11,628
  6. Avatar for Australia 6. Australia 11 pts. 11,594
  7. Avatar for Marvin's bunch 7. Marvin's bunch 7 pts. 11,532
  8. Avatar for VeFold 8. VeFold 4 pts. 11,523
  9. Avatar for Beta Folders 9. Beta Folders 2 pts. 11,252
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 11,053

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,078
  2. Avatar for MicElephant 2. MicElephant Lv 1 94 pts. 11,850
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 88 pts. 11,845
  4. Avatar for BackBuffer 4. BackBuffer Lv 1 83 pts. 11,843
  5. Avatar for blazegeek 5. blazegeek Lv 1 78 pts. 11,815
  6. Avatar for WBarme1234 6. WBarme1234 Lv 1 73 pts. 11,803
  7. Avatar for akaaka 7. akaaka Lv 1 68 pts. 11,791
  8. Avatar for Punzi Baker 3 8. Punzi Baker 3 Lv 1 63 pts. 11,791
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 59 pts. 11,784
  10. Avatar for Galaxie 10. Galaxie Lv 1 55 pts. 11,781

Comments