Icon representing a puzzle

2417: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,095
  2. Avatar for Contenders 2. Contenders 70 pts. 11,850
  3. Avatar for Go Science 3. Go Science 47 pts. 11,845
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 30 pts. 11,803
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 11,628
  6. Avatar for Australia 6. Australia 11 pts. 11,594
  7. Avatar for Marvin's bunch 7. Marvin's bunch 7 pts. 11,532
  8. Avatar for VeFold 8. VeFold 4 pts. 11,523
  9. Avatar for Beta Folders 9. Beta Folders 2 pts. 11,252
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 11,053
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 12,095
  2. Avatar for LociOiling 2. LociOiling Lv 1 52 pts. 12,078
  3. Avatar for phi16 3. phi16 Lv 1 24 pts. 12,056
  4. Avatar for gmn 4. gmn Lv 1 10 pts. 12,025
  5. Avatar for alcor29 5. alcor29 Lv 1 4 pts. 11,871
  6. Avatar for Sandrix72 6. Sandrix72 Lv 1 1 pt. 11,844
  7. Avatar for maithra 7. maithra Lv 1 1 pt. 11,835
  8. Avatar for georg137 8. georg137 Lv 1 1 pt. 11,833
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 1 pt. 11,802

Comments