Icon representing a puzzle

2417: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,095
  2. Avatar for Contenders 2. Contenders 70 pts. 11,850
  3. Avatar for Go Science 3. Go Science 47 pts. 11,845
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 30 pts. 11,803
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 11,628
  6. Avatar for Australia 6. Australia 11 pts. 11,594
  7. Avatar for Marvin's bunch 7. Marvin's bunch 7 pts. 11,532
  8. Avatar for VeFold 8. VeFold 4 pts. 11,523
  9. Avatar for Beta Folders 9. Beta Folders 2 pts. 11,252
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 11,053

  1. Avatar for Antibrad 31. Antibrad Lv 1 10 pts. 11,252
  2. Avatar for manu8170 32. manu8170 Lv 1 9 pts. 11,176
  3. Avatar for alcor29 33. alcor29 Lv 1 8 pts. 11,167
  4. Avatar for ShadowTactics 34. ShadowTactics Lv 1 7 pts. 11,053
  5. Avatar for maithra 35. maithra Lv 1 6 pts. 11,047
  6. Avatar for roarshock 36. roarshock Lv 1 6 pts. 11,033
  7. Avatar for rosie4loop 37. rosie4loop Lv 1 5 pts. 11,025
  8. Avatar for Larini 38. Larini Lv 1 5 pts. 10,920
  9. Avatar for jamiexq 39. jamiexq Lv 1 4 pts. 10,908
  10. Avatar for Vinara 40. Vinara Lv 1 4 pts. 10,894

Comments