Icon representing a puzzle

2417: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,095
  2. Avatar for Contenders 2. Contenders 70 pts. 11,850
  3. Avatar for Go Science 3. Go Science 47 pts. 11,845
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 30 pts. 11,803
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 11,628
  6. Avatar for Australia 6. Australia 11 pts. 11,594
  7. Avatar for Marvin's bunch 7. Marvin's bunch 7 pts. 11,532
  8. Avatar for VeFold 8. VeFold 4 pts. 11,523
  9. Avatar for Beta Folders 9. Beta Folders 2 pts. 11,252
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 11,053
  1. Avatar for gmn 21. gmn Lv 1 24 pts. 11,603
  2. Avatar for AlkiP0Ps 22. AlkiP0Ps Lv 1 22 pts. 11,594
  3. Avatar for georg137 23. georg137 Lv 1 20 pts. 11,533
  4. Avatar for fpc 24. fpc Lv 1 18 pts. 11,532
  5. Avatar for pizpot 25. pizpot Lv 1 17 pts. 11,523
  6. Avatar for heather-1 26. heather-1 Lv 1 15 pts. 11,400
  7. Avatar for Idiotboy 27. Idiotboy Lv 1 14 pts. 11,324
  8. Avatar for hansvandenhof 28. hansvandenhof Lv 1 13 pts. 11,316
  9. Avatar for Hillbillie 29. Hillbillie Lv 1 12 pts. 11,300
  10. Avatar for phi16 30. phi16 Lv 1 11 pts. 11,277

Comments