Icon representing a puzzle

2420: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,190
  2. Avatar for Go Science 2. Go Science 71 pts. 12,174
  3. Avatar for Contenders 3. Contenders 49 pts. 12,013
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 11,916
  5. Avatar for Australia 5. Australia 22 pts. 11,894
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 11,779
  7. Avatar for AlphaFold 7. AlphaFold 8 pts. 11,733
  8. Avatar for VeFold 8. VeFold 5 pts. 11,695
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 3 pts. 11,658
  10. Avatar for Beta Folders 10. Beta Folders 2 pts. 11,497
  1. Avatar for Bletchley Park 11. Bletchley Park Lv 1 59 pts. 11,931
  2. Avatar for Punzi Baker 3 12. Punzi Baker 3 Lv 1 56 pts. 11,928
  3. Avatar for gmn 13. gmn Lv 1 53 pts. 11,926
  4. Avatar for Galaxie 14. Galaxie Lv 1 50 pts. 11,917
  5. Avatar for fpc 15. fpc Lv 1 47 pts. 11,916
  6. Avatar for Steven Pletsch 16. Steven Pletsch Lv 1 44 pts. 11,911
  7. Avatar for AlkiP0Ps 17. AlkiP0Ps Lv 1 42 pts. 11,894
  8. Avatar for akaaka 18. akaaka Lv 1 39 pts. 11,892
  9. Avatar for silent gene 19. silent gene Lv 1 37 pts. 11,875
  10. Avatar for alcor29 20. alcor29 Lv 1 35 pts. 11,842

Comments