Icon representing a puzzle

2420: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,190
  2. Avatar for Go Science 2. Go Science 71 pts. 12,174
  3. Avatar for Contenders 3. Contenders 49 pts. 12,013
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 11,916
  5. Avatar for Australia 5. Australia 22 pts. 11,894
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 11,779
  7. Avatar for AlphaFold 7. AlphaFold 8 pts. 11,733
  8. Avatar for VeFold 8. VeFold 5 pts. 11,695
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 3 pts. 11,658
  10. Avatar for Beta Folders 10. Beta Folders 2 pts. 11,497
  1. Avatar for Hillbillie 41. Hillbillie Lv 1 8 pts. 11,381
  2. Avatar for Larini 42. Larini Lv 1 7 pts. 11,362
  3. Avatar for kitsoune 43. kitsoune Lv 1 7 pts. 11,354
  4. Avatar for zbp 44. zbp Lv 1 6 pts. 11,342
  5. Avatar for Lereveur 45. Lereveur Lv 1 6 pts. 11,284
  6. Avatar for ShadowTactics 46. ShadowTactics Lv 1 5 pts. 11,280
  7. Avatar for Tian00 47. Tian00 Lv 1 5 pts. 11,248
  8. Avatar for Merf 48. Merf Lv 1 4 pts. 11,231
  9. Avatar for pfirth 49. pfirth Lv 1 4 pts. 11,179
  10. Avatar for mttl1mutation 50. mttl1mutation Lv 1 4 pts. 11,169

Comments