Placeholder image of a protein
Icon representing a puzzle

2418: Electron Density Reconstruction 78

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
February 09, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but not every segment may be visible.

Sequence
MAGSSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRIGT

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 22,487
  2. Avatar for OmHS 12. OmHS 1 pt. 22,020
  3. Avatar for That's a Wrap! 13. That's a Wrap! 1 pt. 21,860

  1. Avatar for ShadowTactics 31. ShadowTactics Lv 1 5 pts. 22,669
  2. Avatar for jamiexq 32. jamiexq Lv 1 5 pts. 22,661
  3. Avatar for spvincent 33. spvincent Lv 1 4 pts. 22,656
  4. Avatar for hansvandenhof 34. hansvandenhof Lv 1 4 pts. 22,626
  5. Avatar for kitsoune 35. kitsoune Lv 1 3 pts. 22,617
  6. Avatar for Trajan464 36. Trajan464 Lv 1 3 pts. 22,608
  7. Avatar for maithra 37. maithra Lv 1 2 pts. 22,582
  8. Avatar for zbp 38. zbp Lv 1 2 pts. 22,564
  9. Avatar for pizpot 39. pizpot Lv 1 2 pts. 22,560
  10. Avatar for Karlheinz 40. Karlheinz Lv 1 2 pts. 22,520

Comments