Placeholder image of a protein
Icon representing a puzzle

2418: Electron Density Reconstruction 78

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 09, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but not every segment may be visible.

Sequence
MAGSSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRIGT

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 22,487
  2. Avatar for OmHS 12. OmHS 1 pt. 22,020
  3. Avatar for That's a Wrap! 13. That's a Wrap! 1 pt. 21,860
  1. Avatar for Larini 41. Larini Lv 1 1 pt. 22,493
  2. Avatar for VU21BTEN0100031 42. VU21BTEN0100031 Lv 1 1 pt. 22,487
  3. Avatar for Lereveur 43. Lereveur Lv 1 1 pt. 22,486
  4. Avatar for AaA 44. AaA Lv 1 1 pt. 22,465
  5. Avatar for Oransche 45. Oransche Lv 1 1 pt. 22,434
  6. Avatar for pfirth 46. pfirth Lv 1 1 pt. 22,334
  7. Avatar for Tian00 47. Tian00 Lv 1 1 pt. 22,328
  8. Avatar for Dr.Sillem 48. Dr.Sillem Lv 1 1 pt. 22,323
  9. Avatar for Arne Heessels 49. Arne Heessels Lv 1 1 pt. 22,101
  10. Avatar for Merf 50. Merf Lv 1 1 pt. 22,094

Comments