Placeholder image of a protein
Icon representing a puzzle

2418: Electron Density Reconstruction 78

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 09, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but not every segment may be visible.

Sequence
MAGSSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRIGT

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 22,487
  2. Avatar for OmHS 12. OmHS 1 pt. 22,020
  3. Avatar for That's a Wrap! 13. That's a Wrap! 1 pt. 21,860
  1. Avatar for Mohoernchen 51. Mohoernchen Lv 1 1 pt. 22,086
  2. Avatar for Rawanda 52. Rawanda Lv 1 1 pt. 22,020
  3. Avatar for carxo 53. carxo Lv 1 1 pt. 22,017
  4. Avatar for Dpadillaleos 54. Dpadillaleos Lv 1 1 pt. 21,985
  5. Avatar for rinze 55. rinze Lv 1 1 pt. 21,942
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 21,928
  7. Avatar for liyaoooo 57. liyaoooo Lv 1 1 pt. 21,912
  8. Avatar for BlueEqualsRed 58. BlueEqualsRed Lv 1 1 pt. 21,886
  9. Avatar for AHart313 59. AHart313 Lv 1 1 pt. 21,860
  10. Avatar for furi0us 60. furi0us Lv 1 1 pt. 21,851

Comments