Placeholder image of a protein
Icon representing a puzzle

2418: Electron Density Reconstruction 78

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 09, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but not every segment may be visible.

Sequence
MAGSSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRIGT

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 22,487
  2. Avatar for OmHS 12. OmHS 1 pt. 22,020
  3. Avatar for That's a Wrap! 13. That's a Wrap! 1 pt. 21,860
  1. Avatar for futsall 61. futsall Lv 1 1 pt. 21,851
  2. Avatar for apetrides 62. apetrides Lv 1 1 pt. 21,839
  3. Avatar for Zacka 63. Zacka Lv 1 1 pt. 21,837
  4. Avatar for Jacjac 64. Jacjac Lv 1 1 pt. 16,117
  5. Avatar for Josh6996 65. Josh6996 Lv 1 1 pt. 16,117
  6. Avatar for Macks_27 66. Macks_27 Lv 1 1 pt. 16,117
  7. Avatar for abithaaattt 67. abithaaattt Lv 1 1 pt. 16,117

Comments