Placeholder image of a protein
Icon representing a puzzle

2418: Electron Density Reconstruction 78

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
February 09, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but not every segment may be visible.

Sequence
MAGSSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRIGT

Top groups


  1. Avatar for Go Science 100 pts. 22,890
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 22,884
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 22,854
  4. Avatar for Contenders 4. Contenders 24 pts. 22,841
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 22,835
  6. Avatar for Australia 6. Australia 7 pts. 22,817
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 22,801
  8. Avatar for VeFold 8. VeFold 2 pts. 22,748
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 22,748
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 22,669

  1. Avatar for Galaxie 11. Galaxie Lv 1 44 pts. 22,844
  2. Avatar for MicElephant 12. MicElephant Lv 1 41 pts. 22,841
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 37 pts. 22,835
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 34 pts. 22,835
  5. Avatar for fpc 15. fpc Lv 1 31 pts. 22,835
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 28 pts. 22,831
  7. Avatar for blazegeek 17. blazegeek Lv 1 25 pts. 22,821
  8. Avatar for AlkiP0Ps 18. AlkiP0Ps Lv 1 23 pts. 22,817
  9. Avatar for georg137 19. georg137 Lv 1 21 pts. 22,810
  10. Avatar for Serca 20. Serca Lv 1 19 pts. 22,809

Comments