Placeholder image of a protein
Icon representing a puzzle

2418: Electron Density Reconstruction 78

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 09, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but not every segment may be visible.

Sequence
MAGSSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRIGT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 22,890
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 22,884
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 22,854
  4. Avatar for Contenders 4. Contenders 24 pts. 22,841
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 22,835
  6. Avatar for Australia 6. Australia 7 pts. 22,817
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 22,801
  8. Avatar for VeFold 8. VeFold 2 pts. 22,748
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 22,748
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 22,669
  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 17 pts. 22,801
  2. Avatar for phi16 22. phi16 Lv 1 15 pts. 22,787
  3. Avatar for akaaka 23. akaaka Lv 1 14 pts. 22,759
  4. Avatar for Steven Pletsch 24. Steven Pletsch Lv 1 12 pts. 22,758
  5. Avatar for silent gene 25. silent gene Lv 1 11 pts. 22,756
  6. Avatar for AlphaFold2 26. AlphaFold2 Lv 1 10 pts. 22,748
  7. Avatar for roarshock 27. roarshock Lv 1 9 pts. 22,723
  8. Avatar for guineapig 28. guineapig Lv 1 8 pts. 22,713
  9. Avatar for Idiotboy 29. Idiotboy Lv 1 7 pts. 22,692
  10. Avatar for rosie4loop 30. rosie4loop Lv 1 6 pts. 22,676

Comments