Placeholder image of a protein
Icon representing a puzzle

2421: Electron Density Reconstruction 79

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
February 16, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This case has both a monomer protein and also a bit of DNA as well, so some recipes might struggle with the DNA portion.

Sequence
EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPFPSN TATCGATA

Top groups


  1. Avatar for Beta Folders 11. Beta Folders 2 pts. 9,490
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,110
  3. Avatar for OmHS 13. OmHS 1 pt. 8,869
  4. Avatar for That's a Wrap! 16. That's a Wrap! 1 pt. 6,308
  5. Avatar for GUGITBIOTECH 17. GUGITBIOTECH 1 pt. 0
  6. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 0

  1. Avatar for Bletchley Park 11. Bletchley Park Lv 1 52 pts. 18,122
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 49 pts. 18,096
  3. Avatar for rosie4loop 13. rosie4loop Lv 1 45 pts. 18,051
  4. Avatar for RichGuilmain 14. RichGuilmain Lv 1 42 pts. 17,986
  5. Avatar for fpc 15. fpc Lv 1 39 pts. 17,931
  6. Avatar for alcor29 16. alcor29 Lv 1 36 pts. 17,819
  7. Avatar for ShadowTactics 17. ShadowTactics Lv 1 34 pts. 17,739
  8. Avatar for MicElephant 18. MicElephant Lv 1 31 pts. 17,724
  9. Avatar for Bruno Kestemont 19. Bruno Kestemont Lv 1 29 pts. 17,720
  10. Avatar for BootsMcGraw 20. BootsMcGraw Lv 1 27 pts. 17,654

Comments