Placeholder image of a protein
Icon representing a puzzle

2421: Electron Density Reconstruction 79

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
February 16, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This case has both a monomer protein and also a bit of DNA as well, so some recipes might struggle with the DNA portion.

Sequence
EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPFPSN TATCGATA

Top groups


  1. Avatar for Beta Folders 11. Beta Folders 2 pts. 9,490
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,110
  3. Avatar for OmHS 13. OmHS 1 pt. 8,869
  4. Avatar for That's a Wrap! 16. That's a Wrap! 1 pt. 6,308
  5. Avatar for GUGITBIOTECH 17. GUGITBIOTECH 1 pt. 0
  6. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 0

  1. Avatar for GoForceX 61. GoForceX Lv 1 1 pt. 7,060
  2. Avatar for karolineroettger 62. karolineroettger Lv 1 1 pt. 6,653
  3. Avatar for crahman03 63. crahman03 Lv 1 1 pt. 6,561
  4. Avatar for DScott 64. DScott Lv 1 1 pt. 6,555
  5. Avatar for PerryL 65. PerryL Lv 1 1 pt. 6,523
  6. Avatar for furi0us 66. furi0us Lv 1 1 pt. 6,517
  7. Avatar for AM0003 67. AM0003 Lv 1 1 pt. 6,460
  8. Avatar for mao5455 68. mao5455 Lv 1 1 pt. 6,336
  9. Avatar for AHart313 69. AHart313 Lv 1 1 pt. 6,308
  10. Avatar for Lynly 70. Lynly Lv 1 1 pt. 5,152

Comments