Placeholder image of a protein
Icon representing a puzzle

2421: Electron Density Reconstruction 79

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 16, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This case has both a monomer protein and also a bit of DNA as well, so some recipes might struggle with the DNA portion.

Sequence
EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPFPSN TATCGATA

Top groups

  1. Avatar for Beta Folders 11. Beta Folders 2 pts. 9,490
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,110
  3. Avatar for OmHS 13. OmHS 1 pt. 8,869
  4. Avatar for Penn State Biomolecular Engineers 14. Penn State Biomolecular Engineers 1 pt. 6,653
  5. Avatar for BIOB101 - Discover Biology 15. BIOB101 - Discover Biology 1 pt. 6,523
  6. Avatar for That's a Wrap! 16. That's a Wrap! 1 pt. 6,308
  7. Avatar for GUGITBIOTECH 17. GUGITBIOTECH 1 pt. 0
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 0
  1. Avatar for Claysmith 71. Claysmith Lv 1 1 pt. 4,251
  2. Avatar for I<3Money 72. I<3Money Lv 1 1 pt. 3,781
  3. Avatar for beta_helix 73. beta_helix Lv 1 1 pt. 1,272
  4. Avatar for mickloven 74. mickloven Lv 1 1 pt. 0
  5. Avatar for Rawanda 75. Rawanda Lv 1 1 pt. 0
  6. Avatar for silent gene 76. silent gene Lv 1 1 pt. 0
  7. Avatar for VU21BTEN0100006 Urvee Chatterjee 77. VU21BTEN0100006 Urvee Chatterjee Lv 1 1 pt. 0
  8. Avatar for schweinefett 78. schweinefett Lv 1 1 pt. 0
  9. Avatar for celecchi 79. celecchi Lv 1 1 pt. 0
  10. Avatar for DiscoveryPlaceScience 80. DiscoveryPlaceScience Lv 1 1 pt. 0

Comments