Placeholder image of a protein
Icon representing a puzzle

2427:Electron Density Reconstruction 81

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 28, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 21,148
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 12,466
  1. Avatar for man_the_stan 31. man_the_stan Lv 1 7 pts. 21,839
  2. Avatar for manu8170 32. manu8170 Lv 1 6 pts. 21,745
  3. Avatar for BarrySampson 33. BarrySampson Lv 1 5 pts. 21,708
  4. Avatar for roarshock 34. roarshock Lv 1 5 pts. 21,668
  5. Avatar for alcor29 35. alcor29 Lv 1 4 pts. 21,613
  6. Avatar for ShadowTactics 36. ShadowTactics Lv 1 4 pts. 21,579
  7. Avatar for latin krepin 37. latin krepin Lv 1 3 pts. 21,462
  8. Avatar for Idiotboy 38. Idiotboy Lv 1 3 pts. 21,377
  9. Avatar for Dr.Sillem 39. Dr.Sillem Lv 1 2 pts. 21,343
  10. Avatar for kitsoune 40. kitsoune Lv 1 2 pts. 21,331

Comments