Placeholder image of a protein
Icon representing a puzzle

2427:Electron Density Reconstruction 81

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
February 28, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 22,197
  2. Avatar for Go Science 2. Go Science 63 pts. 22,187
  3. Avatar for Contenders 3. Contenders 37 pts. 22,133
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 22,131
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 22,058
  6. Avatar for Australia 6. Australia 5 pts. 22,045
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 22,045
  8. Avatar for Kotocycle 8. Kotocycle 1 pt. 22,004
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 21,579
  10. Avatar for VeFold 10. VeFold 1 pt. 21,343

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 22,197
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 94 pts. 22,187
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 87 pts. 22,175
  4. Avatar for BackBuffer 4. BackBuffer Lv 1 81 pts. 22,168
  5. Avatar for Galaxie 5. Galaxie Lv 1 75 pts. 22,163
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 70 pts. 22,150
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 64 pts. 22,149
  8. Avatar for Serca 8. Serca Lv 1 60 pts. 22,146
  9. Avatar for MicElephant 9. MicElephant Lv 1 55 pts. 22,133
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 51 pts. 22,131

Comments