Placeholder image of a protein
Icon representing a puzzle

2427:Electron Density Reconstruction 81

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 28, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 21,148
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 12,466
  1. Avatar for jamiexq 41. jamiexq Lv 1 2 pts. 21,326
  2. Avatar for maithra 42. maithra Lv 1 2 pts. 21,320
  3. Avatar for Larini 43. Larini Lv 1 2 pts. 21,286
  4. Avatar for silent gene 44. silent gene Lv 1 1 pt. 21,234
  5. Avatar for zbp 45. zbp Lv 1 1 pt. 21,224
  6. Avatar for VU21BTEN0100009 46. VU21BTEN0100009 Lv 1 1 pt. 21,148
  7. Avatar for carxo 47. carxo Lv 1 1 pt. 21,074
  8. Avatar for ProfVince 48. ProfVince Lv 1 1 pt. 21,062
  9. Avatar for pfirth 49. pfirth Lv 1 1 pt. 21,043
  10. Avatar for mengzach 50. mengzach Lv 1 1 pt. 20,943

Comments