Placeholder image of a protein
Icon representing a puzzle

2427:Electron Density Reconstruction 81

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 28, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 21,148
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 12,466
  1. Avatar for futsall 61. futsall Lv 1 1 pt. 20,331
  2. Avatar for Arlind1 62. Arlind1 Lv 1 1 pt. 19,967
  3. Avatar for adakuanusiem 63. adakuanusiem Lv 1 1 pt. 19,958
  4. Avatar for beta_helix 64. beta_helix Lv 1 1 pt. 19,761
  5. Avatar for BioHazard001 65. BioHazard001 Lv 1 1 pt. 19,292
  6. Avatar for DiscoveryPlaceScience 66. DiscoveryPlaceScience Lv 1 1 pt. 12,791
  7. Avatar for jseffern 67. jseffern Lv 1 1 pt. 12,664
  8. Avatar for RebeccaWebb 68. RebeccaWebb Lv 1 1 pt. 12,583
  9. Avatar for nkhamnei 69. nkhamnei Lv 1 1 pt. 12,498
  10. Avatar for rmoretti 70. rmoretti Lv 1 1 pt. 12,466

Comments