Placeholder image of a protein
Icon representing a puzzle

2427:Electron Density Reconstruction 81

Closed since about 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
February 28, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 21,148
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 12,466

  1. Avatar for envelope 71. envelope Lv 1 1 pt. 12,466

Comments