Icon representing a puzzle

2423: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 9,332
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 9,234
  3. Avatar for OmHS 13. OmHS 1 pt. 8,976
  4. Avatar for BIOTF345 14. BIOTF345 1 pt. 8,858
  5. Avatar for Window Group 15. Window Group 1 pt. 8,361
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,825
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 95 pts. 9,760
  3. Avatar for Serca 3. Serca Lv 1 89 pts. 9,723
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 84 pts. 9,716
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 79 pts. 9,712
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 74 pts. 9,709
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 69 pts. 9,707
  8. Avatar for Galaxie 8. Galaxie Lv 1 65 pts. 9,694
  9. Avatar for BackBuffer 9. BackBuffer Lv 1 61 pts. 9,684
  10. Avatar for ichwilldiesennamen 10. ichwilldiesennamen Lv 1 57 pts. 9,677

Comments