Icon representing a puzzle

2423: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,828
  2. Avatar for Go Science 2. Go Science 70 pts. 9,760
  3. Avatar for Contenders 3. Contenders 47 pts. 9,716
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 9,684
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 9,647
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 9,613
  7. Avatar for Australia 7. Australia 7 pts. 9,602
  8. Avatar for Russian team 8. Russian team 4 pts. 9,527
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 9,419
  10. Avatar for VeFold 10. VeFold 1 pt. 9,398
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,825
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 95 pts. 9,760
  3. Avatar for Serca 3. Serca Lv 1 89 pts. 9,723
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 84 pts. 9,716
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 79 pts. 9,712
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 74 pts. 9,709
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 69 pts. 9,707
  8. Avatar for Galaxie 8. Galaxie Lv 1 65 pts. 9,694
  9. Avatar for BackBuffer 9. BackBuffer Lv 1 61 pts. 9,684
  10. Avatar for ichwilldiesennamen 10. ichwilldiesennamen Lv 1 57 pts. 9,677

Comments