Icon representing a puzzle

2426: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,810
  2. Avatar for That's a Wrap! 12. That's a Wrap! 1 pt. 10,655
  3. Avatar for Beta Folders 13. Beta Folders 1 pt. 9,601
  1. Avatar for blazegeek 11. blazegeek Lv 1 55 pts. 11,953
  2. Avatar for AlkiP0Ps 12. AlkiP0Ps Lv 1 51 pts. 11,940
  3. Avatar for WBarme1234 13. WBarme1234 Lv 1 48 pts. 11,915
  4. Avatar for fpc 14. fpc Lv 1 45 pts. 11,908
  5. Avatar for phi16 15. phi16 Lv 1 42 pts. 11,847
  6. Avatar for Hillbillie 16. Hillbillie Lv 1 39 pts. 11,835
  7. Avatar for Punzi Baker 3 17. Punzi Baker 3 Lv 1 37 pts. 11,831
  8. Avatar for Ikuso 18. Ikuso Lv 1 34 pts. 11,828
  9. Avatar for g_b 19. g_b Lv 1 32 pts. 11,826
  10. Avatar for Bletchley Park 20. Bletchley Park Lv 1 30 pts. 11,812

Comments