Icon representing a puzzle

2426: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,303
  2. Avatar for Go Science 2. Go Science 65 pts. 12,163
  3. Avatar for Contenders 3. Contenders 41 pts. 11,955
  4. Avatar for Australia 4. Australia 24 pts. 11,940
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 11,915
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 11,908
  7. Avatar for VeFold 7. VeFold 4 pts. 11,835
  8. Avatar for Kotocycle 8. Kotocycle 2 pts. 11,828
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 1 pt. 11,774
  10. Avatar for Russian team 10. Russian team 1 pt. 11,092
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,301
  2. Avatar for BackBuffer 2. BackBuffer Lv 1 95 pts. 12,179
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 90 pts. 12,163
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 84 pts. 12,101
  5. Avatar for gmn 5. gmn Lv 1 80 pts. 12,087
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 75 pts. 12,083
  7. Avatar for grogar7 7. grogar7 Lv 1 70 pts. 11,997
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 66 pts. 11,980
  9. Avatar for Galaxie 9. Galaxie Lv 1 62 pts. 11,966
  10. Avatar for MicElephant 10. MicElephant Lv 1 58 pts. 11,955

Comments