Icon representing a puzzle

2426: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,810
  2. Avatar for That's a Wrap! 12. That's a Wrap! 1 pt. 10,655
  3. Avatar for Beta Folders 13. Beta Folders 1 pt. 9,601
  1. Avatar for msmaclennan 41. msmaclennan Lv 1 5 pts. 11,024
  2. Avatar for kitsoune 42. kitsoune Lv 1 5 pts. 10,901
  3. Avatar for envelope 43. envelope Lv 1 4 pts. 10,875
  4. Avatar for papercut 44. papercut Lv 1 4 pts. 10,874
  5. Avatar for Lereveur 45. Lereveur Lv 1 3 pts. 10,873
  6. Avatar for rosie4loop 46. rosie4loop Lv 1 3 pts. 10,866
  7. Avatar for Larini 47. Larini Lv 1 3 pts. 10,855
  8. Avatar for zbp 48. zbp Lv 1 3 pts. 10,818
  9. Avatar for ShadowTactics 49. ShadowTactics Lv 1 2 pts. 10,810
  10. Avatar for jamiexq 50. jamiexq Lv 1 2 pts. 10,750

Comments