Icon representing a puzzle

2426: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 2 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,810
  2. Avatar for That's a Wrap! 12. That's a Wrap! 1 pt. 10,655
  3. Avatar for Beta Folders 13. Beta Folders 1 pt. 9,601
  1. Avatar for morganlovesscience 71. morganlovesscience Lv 1 1 pt. 10,134
  2. Avatar for furi0us 72. furi0us Lv 1 1 pt. 10,118
  3. Avatar for Belle36 73. Belle36 Lv 1 1 pt. 10,092
  4. Avatar for nkhamnei 74. nkhamnei Lv 1 1 pt. 9,943
  5. Avatar for c-lindane 75. c-lindane Lv 1 1 pt. 9,922
  6. Avatar for alopezba 76. alopezba Lv 1 1 pt. 9,887
  7. Avatar for adakuanusiem 77. adakuanusiem Lv 1 1 pt. 9,881
  8. Avatar for fabi61192 78. fabi61192 Lv 1 1 pt. 9,837
  9. Avatar for Antibrad 79. Antibrad Lv 1 1 pt. 9,601
  10. Avatar for Kcat2.22 80. Kcat2.22 Lv 1 1 pt. 9,387

Comments