Icon representing a puzzle

2426: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 2 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,303
  2. Avatar for Go Science 2. Go Science 65 pts. 12,163
  3. Avatar for Contenders 3. Contenders 41 pts. 11,955
  4. Avatar for Australia 4. Australia 24 pts. 11,940
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 11,915
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 11,908
  7. Avatar for VeFold 7. VeFold 4 pts. 11,835
  8. Avatar for Kotocycle 8. Kotocycle 2 pts. 11,828
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 1 pt. 11,774
  10. Avatar for Russian team 10. Russian team 1 pt. 11,092

  1. Avatar for BootsMcGraw 21. BootsMcGraw Lv 1 28 pts. 11,807
  2. Avatar for Serca 22. Serca Lv 1 26 pts. 11,795
  3. Avatar for christioanchauvin 23. christioanchauvin Lv 1 24 pts. 11,774
  4. Avatar for georg137 24. georg137 Lv 1 22 pts. 11,761
  5. Avatar for jausmh 25. jausmh Lv 1 20 pts. 11,734
  6. Avatar for Steven Pletsch 26. Steven Pletsch Lv 1 19 pts. 11,723
  7. Avatar for heather-1 27. heather-1 Lv 1 17 pts. 11,633
  8. Avatar for guineapig 28. guineapig Lv 1 16 pts. 11,614
  9. Avatar for ProfVince 29. ProfVince Lv 1 15 pts. 11,598
  10. Avatar for Idiotboy 30. Idiotboy Lv 1 14 pts. 11,556

Comments