Icon representing a puzzle

2432: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 11,646
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,487
  3. Avatar for Kotocycle 13. Kotocycle 1 pt. 11,396
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,804
  5. Avatar for AlphaFold 15. AlphaFold 1 pt. 10,618
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,949
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,508
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 94 pts. 12,313
  3. Avatar for BackBuffer 3. BackBuffer Lv 1 88 pts. 12,258
  4. Avatar for grogar7 4. grogar7 Lv 1 82 pts. 12,251
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 77 pts. 12,187
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 72 pts. 12,164
  7. Avatar for akaaka 7. akaaka Lv 1 67 pts. 12,140
  8. Avatar for blazegeek 8. blazegeek Lv 1 63 pts. 12,136
  9. Avatar for Aubade01 9. Aubade01 Lv 1 58 pts. 12,118
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 54 pts. 12,106

Comments