Icon representing a puzzle

2432: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,513
  2. Avatar for Go Science 2. Go Science 71 pts. 12,313
  3. Avatar for Contenders 3. Contenders 49 pts. 12,073
  4. Avatar for Australia 4. Australia 33 pts. 12,068
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 12,014
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 11,939
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 11,894
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 11,692
  9. Avatar for Russian team 9. Russian team 3 pts. 11,680
  10. Avatar for VeFold 10. VeFold 2 pts. 11,662

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,508
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 94 pts. 12,313
  3. Avatar for BackBuffer 3. BackBuffer Lv 1 88 pts. 12,258
  4. Avatar for grogar7 4. grogar7 Lv 1 82 pts. 12,251
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 77 pts. 12,187
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 72 pts. 12,164
  7. Avatar for akaaka 7. akaaka Lv 1 67 pts. 12,140
  8. Avatar for blazegeek 8. blazegeek Lv 1 63 pts. 12,136
  9. Avatar for Aubade01 9. Aubade01 Lv 1 58 pts. 12,118
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 54 pts. 12,106

Comments