Icon representing a puzzle

2432: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,513
  2. Avatar for Go Science 2. Go Science 71 pts. 12,313
  3. Avatar for Contenders 3. Contenders 49 pts. 12,073
  4. Avatar for Australia 4. Australia 33 pts. 12,068
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 12,014
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 11,939
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 11,894
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 11,692
  9. Avatar for Russian team 9. Russian team 3 pts. 11,680
  10. Avatar for VeFold 10. VeFold 2 pts. 11,662

  1. Avatar for Bletchley Park 21. Bletchley Park Lv 1 23 pts. 11,935
  2. Avatar for christioanchauvin 22. christioanchauvin Lv 1 21 pts. 11,894
  3. Avatar for Steven Pletsch 23. Steven Pletsch Lv 1 19 pts. 11,892
  4. Avatar for BarrySampson 24. BarrySampson Lv 1 17 pts. 11,885
  5. Avatar for guineapig 25. guineapig Lv 1 16 pts. 11,863
  6. Avatar for georg137 26. georg137 Lv 1 15 pts. 11,832
  7. Avatar for latin krepin 27. latin krepin Lv 1 13 pts. 11,830
  8. Avatar for alcor29 28. alcor29 Lv 1 12 pts. 11,819
  9. Avatar for orily1337 29. orily1337 Lv 1 11 pts. 11,761
  10. Avatar for silent gene 30. silent gene Lv 1 10 pts. 11,751

Comments