Icon representing a puzzle

2432: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,513
  2. Avatar for Go Science 2. Go Science 71 pts. 12,313
  3. Avatar for Contenders 3. Contenders 49 pts. 12,073
  4. Avatar for Australia 4. Australia 33 pts. 12,068
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 12,014
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 11,939
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 11,894
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 11,692
  9. Avatar for Russian team 9. Russian team 3 pts. 11,680
  10. Avatar for VeFold 10. VeFold 2 pts. 11,662

  1. Avatar for maithra 31. maithra Lv 1 9 pts. 11,751
  2. Avatar for Joanna_H 32. Joanna_H Lv 1 8 pts. 11,692
  3. Avatar for Gerom 33. Gerom Lv 1 7 pts. 11,680
  4. Avatar for heather-1 34. heather-1 Lv 1 7 pts. 11,675
  5. Avatar for carsonfb 35. carsonfb Lv 1 6 pts. 11,663
  6. Avatar for Hillbillie 36. Hillbillie Lv 1 5 pts. 11,662
  7. Avatar for rosie4loop 37. rosie4loop Lv 1 5 pts. 11,647
  8. Avatar for Larini 38. Larini Lv 1 4 pts. 11,647
  9. Avatar for erlorad 39. erlorad Lv 1 4 pts. 11,647
  10. Avatar for VU21BTEN0100031 40. VU21BTEN0100031 Lv 1 3 pts. 11,646

Comments