Icon representing a puzzle

2432: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 2 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,513
  2. Avatar for Go Science 2. Go Science 71 pts. 12,313
  3. Avatar for Contenders 3. Contenders 49 pts. 12,073
  4. Avatar for Australia 4. Australia 33 pts. 12,068
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 12,014
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 11,939
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 11,894
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 11,692
  9. Avatar for Russian team 9. Russian team 3 pts. 11,680
  10. Avatar for VeFold 10. VeFold 2 pts. 11,662

  1. Avatar for furi0us 71. furi0us Lv 1 1 pt. 10,620
  2. Avatar for AlphaFold2 72. AlphaFold2 Lv 1 1 pt. 10,618
  3. Avatar for tajosebedolu 73. tajosebedolu Lv 1 1 pt. 10,107
  4. Avatar for mikolajek326 74. mikolajek326 Lv 1 1 pt. 9,835
  5. Avatar for Deleted player 75. Deleted player 1 pt. 9,832
  6. Avatar for yAn12328038 76. yAn12328038 Lv 1 1 pt. 8,949
  7. Avatar for spvincent 77. spvincent Lv 1 1 pt. 8,949
  8. Avatar for agcohn821 78. agcohn821 Lv 1 1 pt. 8,949

Comments