Icon representing a puzzle

2435: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,281
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 1 pt. 10,169
  3. Avatar for BioInformatics2024 13. BioInformatics2024 1 pt. 9,693
  4. Avatar for SHELL 14. SHELL 1 pt. 7,965

  1. Avatar for grogar7 11. grogar7 Lv 1 53 pts. 11,159
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 49 pts. 11,139
  3. Avatar for g_b 13. g_b Lv 1 46 pts. 11,122
  4. Avatar for BootsMcGraw 14. BootsMcGraw Lv 1 43 pts. 11,101
  5. Avatar for AlkiP0Ps 15. AlkiP0Ps Lv 1 40 pts. 11,100
  6. Avatar for MicElephant 16. MicElephant Lv 1 37 pts. 11,041
  7. Avatar for georg137 17. georg137 Lv 1 34 pts. 11,017
  8. Avatar for fpc 18. fpc Lv 1 32 pts. 11,008
  9. Avatar for Marvelz 19. Marvelz Lv 1 29 pts. 10,954
  10. Avatar for Bletchley Park 20. Bletchley Park Lv 1 27 pts. 10,930

Comments