Icon representing a puzzle

2435: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,530
  2. Avatar for Go Science 2. Go Science 68 pts. 11,324
  3. Avatar for Contenders 3. Contenders 44 pts. 11,101
  4. Avatar for Australia 4. Australia 27 pts. 11,100
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 11,008
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,925
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 10,923
  8. Avatar for VeFold 8. VeFold 3 pts. 10,733
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,611
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 10,559

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,530
  2. Avatar for Aubade01 2. Aubade01 Lv 1 95 pts. 11,415
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 89 pts. 11,324
  4. Avatar for Sandrix72 4. Sandrix72 Lv 1 83 pts. 11,323
  5. Avatar for BackBuffer 5. BackBuffer Lv 1 78 pts. 11,284
  6. Avatar for Serca 6. Serca Lv 1 74 pts. 11,246
  7. Avatar for Galaxie 7. Galaxie Lv 1 69 pts. 11,230
  8. Avatar for Punzi Baker 3 8. Punzi Baker 3 Lv 1 65 pts. 11,200
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 60 pts. 11,184
  10. Avatar for blazegeek 10. blazegeek Lv 1 56 pts. 11,175

Comments