Icon representing a puzzle

2435: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,281
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 1 pt. 10,169
  3. Avatar for BioInformatics2024 13. BioInformatics2024 1 pt. 9,693
  4. Avatar for SHELL 14. SHELL 1 pt. 7,965
  1. Avatar for ProfVince 41. ProfVince Lv 1 4 pts. 10,269
  2. Avatar for Vinara 42. Vinara Lv 1 4 pts. 10,217
  3. Avatar for JackONeill12 43. JackONeill12 Lv 1 3 pts. 10,210
  4. Avatar for VU21BTEN0100033 44. VU21BTEN0100033 Lv 1 3 pts. 10,169
  5. Avatar for pfirth 45. pfirth Lv 1 3 pts. 10,160
  6. Avatar for zbp 46. zbp Lv 1 2 pts. 10,152
  7. Avatar for VU21BTEN0100050 47. VU21BTEN0100050 Lv 1 2 pts. 10,139
  8. Avatar for Karlheinz 48. Karlheinz Lv 1 2 pts. 10,138
  9. Avatar for Kvaksius 49. Kvaksius Lv 1 2 pts. 10,134
  10. Avatar for phi16 50. phi16 Lv 1 2 pts. 10,092

Comments