Icon representing a puzzle

2435: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,281
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 1 pt. 10,169
  3. Avatar for BioInformatics2024 13. BioInformatics2024 1 pt. 9,693
  4. Avatar for SHELL 14. SHELL 1 pt. 7,965

  1. Avatar for rinze 61. rinze Lv 1 1 pt. 9,863
  2. Avatar for carxo 62. carxo Lv 1 1 pt. 9,791
  3. Avatar for Hellcat6 63. Hellcat6 Lv 1 1 pt. 9,767
  4. Avatar for MasterMicro 65. MasterMicro Lv 1 1 pt. 9,693
  5. Avatar for froschi2 66. froschi2 Lv 1 1 pt. 9,673
  6. Avatar for ongsa 67. ongsa Lv 1 1 pt. 9,623
  7. Avatar for pruneau_44 68. pruneau_44 Lv 1 1 pt. 9,579
  8. Avatar for jamiexq 69. jamiexq Lv 1 1 pt. 9,555
  9. Avatar for ppu 70. ppu Lv 1 1 pt. 9,482

Comments