Icon representing a puzzle

2435: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,281
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 1 pt. 10,169
  3. Avatar for BioInformatics2024 13. BioInformatics2024 1 pt. 9,693
  4. Avatar for SHELL 14. SHELL 1 pt. 7,965

  1. Avatar for Belle36 71. Belle36 Lv 1 1 pt. 9,473
  2. Avatar for futsall 72. futsall Lv 1 1 pt. 9,466
  3. Avatar for furi0us 73. furi0us Lv 1 1 pt. 9,437
  4. Avatar for Arlind1 74. Arlind1 Lv 1 1 pt. 9,422
  5. Avatar for RAM 75. RAM Lv 1 1 pt. 9,339
  6. Avatar for JOE.CADILLAC555 77. JOE.CADILLAC555 Lv 1 1 pt. 8,887
  7. Avatar for sarcastic_seth 78. sarcastic_seth Lv 1 1 pt. 8,712
  8. Avatar for greggyace 79. greggyace Lv 1 1 pt. 7,968
  9. Avatar for jtobrien 80. jtobrien Lv 1 1 pt. 7,965

Comments